| << Chapter < Page | Chapter >> Page > |
MEPRDPSPEARSSDSESASASSSGSERDADPEPDKAPRRLTKRRFPGLRLFGHRKAITKSGLQHLAPPPP
TPGAPCGESERQIRSTVDWSESAAYGEHIWFETNVSGDFCYVGEQYCVAKMLPKSAPRRKCAACKIVVHTPCIGQLEKINFRCKPSFRESGSRNVREPTFVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSW
CKQAYHSKVSCFMLQQIEEPCSLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRRSSKKGPEEGRWRPFIIRPTPSPLMKPLLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPREALEMYRKVHNLRIL
ACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLRAEPNPEAGPEERDDGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAF
SDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCIVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVLLTTAKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRS
TAPLHSDQQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPMCHPLSSKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSP
LPASPCSPTPGSLQGDAALPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDHQSRTLLHHAVSTGSKEVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAY
LENRQHYQMIQREDQETAV
First, view the "k-NN" results by scrolling to the bottom of the page. The k-nearest neighbor (k-NN) algorithm takes theoutput of the many subprograms and determines a probability of localization at each candidatesite within the cell using all of the predictions.
What is the probability the sequence encodes a protein that is (a) secreted by vesicles?(b) localized to the endoplasmic reticulum? (c) cytoplasmic? or(d) localized to the nucleus?
Now, scroll through the results of the subprograms. Clicking on the links will reveal a brief description of the algorithm each individual subprogram utilizes.
What is the localization prediction and reliability score produced by the NNCN subprogram, Reinhardt's methods forcytoplasmic/nuclear discrimination?
The first two subprograms, PSG and GvH, are tools that predict N-terminal signal peptide sequences. Just after their results are listed, there is a statementsummarizing whether or not an N-terminal signal peptide has been predicted for the query sequence.
Do these subprograms predict an N-terminal signal peptide for the diacylglycerol kinase query?
After looking over all the results, what is the most likely localization of our query protein?
Read the title and abstract for this article on the Rat diacylglycerol kinase used for the query sequence.
Was PSORT able to predict the correct localization, using the sequence information alone?
Return to the
ExPASy tools ,
and scroll to the section entitled "primary structure analysis".Click on the link for the ProtParam tool. ProtParam is a suite of programs
designed to predict various chemical and physical properties about a proteinfrom its sequence. ProtParam will yield an estimated extinction coefficient
at selected wavelengths based on protein sequence
(6) ,
an estimation of the
What is the molecular weight computed from the sequence?
Notification Switch
Would you like to follow the 'Bios 533 bioinformatics' conversation and receive update notifications?
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|